Protein Info for BBR_RS14655 in Bifidobacterium breve UCC2003

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF12833: HTH_18" amino acids 28 to 105 (78 residues), 78.8 bits, see alignment E=6.1e-26 PF00165: HTH_AraC" amino acids 67 to 105 (39 residues), 42.8 bits, see alignment 8.3e-15 PF06445: GyrI-like" amino acids 133 to 286 (154 residues), 81.4 bits, see alignment E=1.7e-26 PF14526: Cass2" amino acids 136 to 285 (150 residues), 73.4 bits, see alignment E=4.8e-24

Best Hits

KEGG orthology group: K13653, AraC family transcriptional regulator (inferred from 100% identity to bln:Blon_1688)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>BBR_RS14655 AraC family transcriptional regulator (Bifidobacterium breve UCC2003)
MKRYPPLERAITYIEAHLNEYIGLNEVSRETGYSYYYMTRLFSSVLGESVGHYINRRRLY
NASEKLIHSDQKVIDIALDCGYESSEAFSRAFKAVFGYSPVAYRKAGLDLVIKAKKELAP
EDVCHIANHISHAPKIILLGETEVAGLRGTTSLSDNQLPGLWEQFHGLNKDFFTTSAGYG
ICETQKTAYTKDGDALYSVMIGGPVKDFDCLPLELAKKTLRAGRYAVFTHRGTLGNLYKT
YQYIFGTWLQTTREELDDREDFEVYEHEILSFDDPDNEVKIFIPIK