Protein Info for BBR_RS14645 in Bifidobacterium breve UCC2003

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 16 to 41 (26 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 106 (97 residues), 93.4 bits, see alignment E=5.1e-31 PF00528: BPD_transp_1" amino acids 32 to 213 (182 residues), 67.1 bits, see alignment E=8.5e-23

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 60% identity to lbh:Lbuc_0231)

Predicted SEED Role

"ABC transporter membrane-spanning permease - glutamine transport"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>BBR_RS14645 amino acid ABC transporter permease (Bifidobacterium breve UCC2003)
MNWEVIQASLPLFGKAFVLTLRLSAISVVLATLLGLVLALLREYRVPVLAQISTVFEELF
RNTPLLIQLFFLYYGFPSIGIKWSAEICAVVGMSILGSAYMSGAFQGGFSGIPQVQNESA
RALGLSPLQMIRHVTLPQGLTRSVPAVAANVIFMVKETSVFTVIAVPELTNTARDLIGMY
YRSDEYLLELVIAYAIILIPLSVILTLLERRVRRGTFGDN