Protein Info for BBR_RS14615 in Bifidobacterium breve UCC2003

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 822 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 493 to 511 (19 residues), see Phobius details amino acids 529 to 546 (18 residues), see Phobius details amino acids 556 to 584 (29 residues), see Phobius details amino acids 639 to 663 (25 residues), see Phobius details PF07730: HisKA_3" amino acids 245 to 307 (63 residues), 52.6 bits, see alignment 5.6e-18 PF02518: HATPase_c" amino acids 348 to 438 (91 residues), 35.3 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: None (inferred from 72% identity to bll:BLJ_0803)

Predicted SEED Role

"histidine kinase sensor of two-component system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (822 amino acids)

>BBR_RS14615 histidine kinase (Bifidobacterium breve UCC2003)
MVAHVRAWFARKPSHTLLWDTLLAAVLTFGLIPLISSTSSSSTPGLLFVSNNYSLLFWSL
PTFVPLMLRRYQPEIAAWLFVALTAAHLVFGPSMTYGDFYTLIILYSVLVYGNPKHSLRF
IITAFAMGLAAAAVWAVSMNVGPLFKSGSSNAWTAWISWLPTAATMPICPASPGLISEPS
VSNCGIKMLRDTGVLALCMEISVLSIIIMALWQRARKATLTAMRERNASIVAREAEETHI
AALAERARIARDMHDVVAHTLSTIIVQSDGGRYAGTHDLAVAKHTMSTIRHEAERAQHDM
QRLFGVFGTDDDAGYADIDSLFDGHLVVSRRVTGKSRPDRLTSDADAAVFRLVQEALTNT
RKHAGEGAKATIDEVWSDDGLAITVSDNGQGAASAADGHAPGYGLMGMHERIESLGGSIH
AGPGPNGGFIVAATIPLSPEIAQTDAEPSDALPVTITRLRKLLDSIRSKPLNQGDIGESN
WVARFAQWTERHYLLADILITVALIAMFSSATRNELQMMTVSNDPVQPNTVLTMALTIIM
LAPLAFRRRFPEGSALVMAILSAVQLLFLPSILTVNMFALVSVHAAALYGREQAWKWVSV
ALVADSWLAGIKAMSGWNGYDMLIQMLLPLNGESAMSRWLLVLSGLIPGGVVMLFGFACI
AMARWSRSRGSNALVLMQREEALKAEQERQKVLAANLERNRIGTAMQAEVLNTLESVITQ
ADDGLAMLNSEPVPDSEQIIAAFTVIGERGRAALAHMRQLLTVLRETGFSDEMHEGAQPD
MQLRPAAPLSSQMRQVESTSQTDSSTNMNSGNNQGVHGAALE