Protein Info for BBR_RS14575 in Bifidobacterium breve UCC2003

Annotation: YraN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 TIGR00252: TIGR00252 family protein" amino acids 23 to 123 (101 residues), 88.3 bits, see alignment E=1.9e-29 PF08378: NERD" amino acids 26 to 82 (57 residues), 25.4 bits, see alignment E=1.7e-09 PF02021: UPF0102" amino acids 29 to 122 (94 residues), 97.7 bits, see alignment E=4.2e-32

Best Hits

Swiss-Prot: 82% identical to Y935_BIFLO: UPF0102 protein BL0935 (BL0935) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K07460, putative endonuclease (inferred from 78% identity to blf:BLIF_0713)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>BBR_RS14575 YraN family protein (Bifidobacterium breve UCC2003)
MNDAATSTEHIAAAMGDRNLSPKQFGALGERYAAVWLEKKGWTTLSHNWRTRYGELDLVM
LNDEHTVVFVEVKSRRTIQYGCPQEAVTPAKQQNIRKAACDWLLDCRNRISHKAVRFDVI
TIVLRAGRPLVHHIENAF