Protein Info for BBR_RS14570 in Bifidobacterium breve UCC2003

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00368: Mg chelatase-like protein" amino acids 9 to 505 (497 residues), 478.2 bits, see alignment E=1.4e-147 PF13541: ChlI" amino acids 21 to 143 (123 residues), 125.6 bits, see alignment E=2.6e-40 PF05362: Lon_C" amino acids 45 to 163 (119 residues), 39.2 bits, see alignment E=1.5e-13 PF01078: Mg_chelatase" amino acids 200 to 403 (204 residues), 288.8 bits, see alignment E=4.9e-90 PF13335: Mg_chelatase_C" amino acids 413 to 507 (95 residues), 74.7 bits, see alignment E=1.8e-24

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 86% identity to blm:BLLJ_0684)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>BBR_RS14570 ATP-binding protein (Bifidobacterium breve UCC2003)
MAIGSALSVGLIGLKAFIVQVQAFISPGLPYFSIIGLPDTSLSEARERVKSACQASGFSW
PQTRVTVNMSPASLPKRGSSHDLAIAASVLCAAGAIGHDCLEDTIVLGEVNLDGSVLPIH
GLLPIMLHAQERGIRKVIIPYRNLDEASMVEDMDAIGVRHVGELIELMGGNASYTIPDLQ
LAEDASASEQAEVSENGYADMNEVLGQEHAKWTLQVAAAGGHNLIMTGPPGTGKTMLASR
LPGIMCPLEDTEQLEVASIRSLCGTLSQYGITDVPPFEAPHHTASTASLVGGGSGIAAPG
AITRAHRGILFLDEAPEFSARALQTLREPLESGYVALSRSKGSTYYPAAFQLVMAANPCP
CGYYYGTGERCRCREKDRMRYFSRLSGPVLDRVDIQMTVPPVPRITVQHEPLGESSATIR
ARVIRARNAAKDRFQQFGWTCNAQASGTWLHANTSLKAMELVNRALSSQQLTLRGADRAM
RLAWTLADLAGRISPTEQDVHQGIEMRTRVS