Protein Info for BBR_RS14520 in Bifidobacterium breve UCC2003

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 270 to 287 (18 residues), see Phobius details TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 6 to 437 (432 residues), 577.1 bits, see alignment E=1.1e-177 PF06689: zf-C4_ClpX" amino acids 13 to 49 (37 residues), 61.2 bits, see alignment 2.9e-20 PF00158: Sigma54_activat" amino acids 123 to 218 (96 residues), 20.8 bits, see alignment E=1.1e-07 PF00493: MCM" amino acids 139 to 220 (82 residues), 25.2 bits, see alignment E=3.3e-09 PF07724: AAA_2" amino acids 140 to 336 (197 residues), 113.2 bits, see alignment E=5.3e-36 PF07728: AAA_5" amino acids 142 to 219 (78 residues), 30.5 bits, see alignment E=1.4e-10 PF00004: AAA" amino acids 143 to 247 (105 residues), 60.9 bits, see alignment E=7.2e-20 PF10431: ClpB_D2-small" amino acids 343 to 420 (78 residues), 47.2 bits, see alignment E=7.4e-16

Best Hits

Swiss-Prot: 90% identical to CLPX_BIFLO: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 90% identity to blf:BLIF_0705)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>BBR_RS14520 ATP-dependent Clp protease ATP-binding subunit ClpX (Bifidobacterium breve UCC2003)
MGRVVSYNEDIPRCTFCGKTERQVRKLVAGPNASICDECIALCVDIISEERSKDAEVNSL
SLPKPTQIFDYLNRYVIGQEEAKRALSVAVYNHYKRVNMELQESAEQLDGANGNAALQSA
GRARKSQRANDPLSDVEVAKSNILLLGPTGVGKTYLAQSLARVMNVPFVITDATTLTEAG
YVGDDVETVLQRLLQAADGDVSRAQHGIIYIDEIDKIARKSGENTSITRDVSGEGVQQAL
LKILEGTIASVPLEGTRKHKEQDTVQMDTCGILFICGGAFVGLTDIVRKRLGRRETGFGA
NWHDADLKDEELLKQVNADDLAEFGLLPEFIGRLPVTSVLKELTVDDLTEILTQPANALI
KQYRKLFAVDGVDLEFTDQAVQAIADTAIKQGIGARGLRSIIERTLQDTMFQLPSLEDVK
QVVVDKASVEGTSAPKLLRETVIQESAERRRTA