Protein Info for BBR_RS14515 in Bifidobacterium breve UCC2003

Annotation: ATP-dependent Clp protease proteolytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00574: CLP_protease" amino acids 47 to 225 (179 residues), 252.4 bits, see alignment E=1.4e-79

Best Hits

Swiss-Prot: 95% identical to CLPP1_BIFLO: ATP-dependent Clp protease proteolytic subunit 1 (clpP1) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 95% identity to bln:Blon_1707)

MetaCyc: 53% identical to ATP-dependent Clp protease proteolytic subunit (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>BBR_RS14515 ATP-dependent Clp protease proteolytic subunit (Bifidobacterium breve UCC2003)
MASEEAKFAARADRLAGRQGVAGFMPAAAPTNRYIMPQFVEKTPYGMKTQDAYSRLFEDR
IIFLGVQVDDASADDVMAQLLVLESQDPNRDVMMYINSPGGSMTAMTAIYDTMQYIKPDV
QTVCLGQAASAAAILLASGTKGKRLMLPNARVLIHQPAIDQGFGKATEIEIQAKEMLRMR
EWLEETLANHTGQDVEKIRRDIEVDTFLTADEAKDYGIVDEVLAHRQ