Protein Info for BBR_RS14500 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 191 to 208 (18 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details amino acids 441 to 462 (22 residues), see Phobius details PF00654: Voltage_CLC" amino acids 70 to 457 (388 residues), 218.1 bits, see alignment E=9.8e-69

Best Hits

KEGG orthology group: None (inferred from 77% identity to bbi:BBIF_1179)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>BBR_RS14500 hypothetical protein (Bifidobacterium breve UCC2003)
MQPVVTAKRLGWLAATTIILGVIIGAGAGLLTLLLYGVEHVMLGYVEGSELPGPFGVPAV
RRAISVTIGLAVAGVIWYFLRNKTTKVPSVKKAVAGERMPVWQTLVHVVLQIGIVGSGAS
IGREVAPRELGAMLAQRFCDLFHIEGADGIDRRMVVAVAAGAGLGGVYNAPLAGMFFAVE
ILLVDVTLEKVAFGLGMSAIAAFVAASIKGHHTFYDITAMQPQSTPTLMLFAVLCGAACG
VAGAWFRKGSQWAESHQSHDKHILWQMPLAGLVTGLAAIVVPQVMGNGRAAAQLGFSTFV
PEGSAAAGASQSASSAAASPWNLLAGGGNVSGSASTAVNAGFQLSQSNIAMLLGVLALTF
VAKALVTLMTIRSGASGGVLQPGIALGSTLGAMLGLIWILLFPADSVTACALIGAAALLS
ASQQAPLMAMCLVMELTEAPSAFFVPVGLAVAASSLVPKWMLSRRK