Protein Info for BBR_RS14480 in Bifidobacterium breve UCC2003

Annotation: pyruvate formate-lyase 1-activating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02493: pyruvate formate-lyase 1-activating enzyme
  • amino acids 56 to 288 (233 residues), 344.3 bits, E=3e-107
• PF13353: Fer4_12
  • amino acids 65 to 183 (119 residues), 69.6 bits, E=3.7e-23
• PF04055: Radical_SAM
  • amino acids 74 to 227 (154 residues), 86.4 bits, E=2.6e-28

Best Hits

Swiss-Prot: 40% identical to PFLA_CLOPA: Pyruvate formate-lyase-activating enzyme (act) from Clostridium pasteurianum

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 98% identity to bll:BLJ_0780)

MetaCyc: 40% identical to Pfl-activating enzyme (Clostridium pasteurianum)
[Formate-C-acetyltransferase]-activating enzyme. [EC: 1.97.1.4]

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• reductive monocarboxylic acid cycle (1/2 steps found)
• mixed acid fermentation (11/16 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Protein Sequence (293 amino acids)

>BBR_RS14480 pyruvate formate-lyase 1-activating enzyme (Bifidobacterium breve UCC2003)
MPATPTFRTTTRHMLKESKTYASQTLMGGLSGFESPIGLDRRDRLSALKSGDIGFVHSWD
INTSVDGPGTRMTVFMSGCPLRCQYCQNPDTWKMRDGKPVYLDAMIKKVDRYKDLFKATH
GGITFSGGESMMQPAFVSRVFHAAKEMGVHTCLDTSGFLNTNYTDEMLEDIDLCLLDVKS
GDEETYHKVTGGTLQPTIDFGQRLAKAGKKIWVRFVLVPGLTDSEENVENVAKICETFGD
SVEHIDVLGFHQLGRPKWHELRIPYPLENQKGPNAATRERVAKQFKDHGFTVY