Protein Info for BBR_RS14460 in Bifidobacterium breve UCC2003

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01891: amidohydrolase
  • amino acids 11 to 358 (348 residues), 323.3 bits, E=1e-100
• PF01546: Peptidase_M20
  • amino acids 71 to 376 (306 residues), 139 bits, E=2.1e-44
• PF07687: M20_dimer
  • amino acids 179 to 279 (101 residues), 42.5 bits, E=5.4e-15

Best Hits

Swiss-Prot: 42% identical to YTNL_BACSU: Uncharacterized hydrolase YtnL (ytnL) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 94% identity to blb:BBMN68_703)

MetaCyc: 42% identical to N-acetyl-L-cysteine deacetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

MetaCyc Pathways

• S-(2-succinyl)-L-cysteine degradation (2/4 steps found)
• S-benzyl-L-cysteine degradation (1/5 steps found)

Protein Sequence (383 amino acids)

>BBR_RS14460 amidohydrolase (Bifidobacterium breve UCC2003)
MSEHIDIDHELIAIRHYLHAHPERSFQEFDTSIYLTDQLKAHGIEILPNSMETGVVGLIQ
GEAGPGTRIGLRADIDGLPIVEDSGLEFSSVNKGVMHGCGHDLHMTGLLGAAFWLANHRD
KFAGSIKILFQPSEETGQGARAMIDAGLVDDVDAIIGTHNNPNYAPGQLAIGVEPMMAGC
VKFHVTLHAQGTHAAYPYKGTGPLEALASMILSLQTIVSRNVMPFHPLVLSVTEVHGGDV
WNVVPAEAGFQGTVRYFHKEDGNLVGRRFKEVVEHTAEAYGITADVDWNDFQDPLVSNPS
LAKAVAADVNDYAQLEPIRPSMAGEDFCEFAKVTLPVFAFVGSNGQEGCADWHSPHFVGL
DESIPTFVNFYVNAALRVLNELR