Protein Info for BBR_RS14455 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 147 to 177 (31 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 40 to 224 (185 residues), 57.1 bits, see alignment E=1e-19

Best Hits

Swiss-Prot: 42% identical to METI_VIBCH: Probable D-methionine transport system permease protein MetI (metI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 95% identity to bll:BLJ_0775)

MetaCyc: 41% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>BBR_RS14455 ABC transporter permease (Bifidobacterium breve UCC2003)
MITLANPRSDWTVLRPLLFESIGQTLTMVLITLVVGGLLGLILGVVLYGTRPGNLFESAI
VYRILDVIVNIVRPIPFIIFLAAMQPLTIVVVGTSIGTVAAIFPMVVMCTFATSRLVEQN
LVPVDPGVIEAARSMGASKFTIIRTVLIPEALAPLILAYAFLFIGVLDMSAMAGYIGGGG
LGNFAIAYGYQKFDQTVTWTAVIIMIVLVQVVQGIANAIAKRLLKRQQ