Protein Info for BBR_RS14450 in Bifidobacterium breve UCC2003

Annotation: methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 28 to 176 (149 residues), 132.3 bits, E=1.9e-42
• PF09383: NIL
  • amino acids 296 to 347 (52 residues), 30.8 bits, 2.1e-11

Best Hits

Swiss-Prot: 91% identical to METN_BIFLO: Methionine import ATP-binding protein MetN (metN) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 91% identity to blj:BLD_0698)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Protein Sequence (400 amino acids)

>BBR_RS14450 methionine ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MSDPIITFDHVVKEFKIRGRKAETARAVNDVSLSIDRGDIFGIIGYSGAGKSTLVRLINA
LERPTSGTVTVLGTDITALNESKLRPIRQKIGMIFQQFNLFSTKTVSQNIAYPLQLDHWR
KDYQDRRVKELLEFVGLAEHADKYPSQLSGGQKQRVGIARALATNPEILLADEATSALDP
ETTTEVLALLKRVNEEFGITIVLITHQMNVVQQIANRVAVMSSGRVVESGDVYDVFAAPR
QPVTKRFIATALSGLPEESRVERLHGEWSGRIVTVLIRQKDVSDDHGRTLHASGQNISEL
IAKYGVESSLLYGGIDTVKGSAIGAITYEFNGPGWHVDEFLRELAQHSDVIDFGTAEKPV
AYADAVANHIAGAEAAIANQQSVSQDESAEISASHEGANA