Protein Info for BBR_RS14445 in Bifidobacterium breve UCC2003

Annotation: Solute-binding protein of ABC transporter system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details PF03180: Lipoprotein_9" amino acids 65 to 300 (236 residues), 211.2 bits, see alignment E=6.6e-67

Best Hits

KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 94% identity to blm:BLLJ_0662)

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>BBR_RS14445 Solute-binding protein of ABC transporter system (Bifidobacterium breve UCC2003)
MTAATQTATPAAPNSNEPVRVNHTARNIIITIVVVAIIAVAAFFGYRAVAGANESSAKGS
KDNPVKIGVVGATNPEWVKFKQNAEKAGIYVDIVDFQDYTSENPALDSGELDLNEFQHLF
YLANYNVSNNKDLQPIGGTAIYPLGVYSTKVKDIKDIKQGDTVTIPNDETNQARAIGVLK
AAGLVTLKGDWTAFSTPADIDEAKSKVKVTPLKAEQVATTLKDPTIAAGVINNDYVADAG
LNPKDAIYQDDVESEEARPYINVWVARKTDVNNETYKKLVSIFQQKDVLDALQENSGGTA
VFADKFSAKQLQGFLSDIEKDAKAQK