Protein Info for BBR_RS14425 in Bifidobacterium breve UCC2003

Annotation: histidine phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00300: His_Phos_1
  • amino acids 9 to 201 (193 residues), 138.5 bits, E=1.1e-44

Best Hits

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 86% identity to blm:BLLJ_0645)

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycolysis II (from fructose 6-phosphate) (8/11 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• gluconeogenesis I (7/13 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (15/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
• superpathway of hexitol degradation (bacteria) (9/18 steps found)
• photorespiration II (3/10 steps found)
• glycerol degradation to butanol (7/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (7/18 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (13/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (12/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (16/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Protein Sequence (233 amino acids)

>BBR_RS14425 histidine phosphatase family protein (Bifidobacterium breve UCC2003)
MTAQHVRSIFLVRHGRTSYNAAHKLQGQVDIPLDAVGQWQVRQTAAALKDLYVDRRPETD
ERIIVCSDLSRAHATAQAFADVLDGAEVHDDPRVRERSFGDWDGHAVSELAERYPEDFRS
WMEHRGGEMKYGAEAKEHVGERGVEALRDWSTRAGTDTDLFVFSHGAWIAQTLQTLLGIT
AVDPTFSTVISMRNAHWVRLVPMDEPDDTIRWRLMDYNHGPAVADTDEWERER