Protein Info for BBR_RS14405 in Bifidobacterium breve UCC2003

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 6 to 188 (183 residues), 237.2 bits, E=9e-75
• PF00117: GATase
  • amino acids 7 to 188 (182 residues), 161.3 bits, E=5.5e-51
• PF07722: Peptidase_C26
  • amino acids 70 to 171 (102 residues), 38.8 bits, E=2.3e-13
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 201 to 520 (320 residues), 485 bits, E=9.5e-150
• PF02540: NAD_synthase
  • amino acids 202 to 280 (79 residues), 31 bits, E=3.6e-11
• PF03054: tRNA_Me_trans
  • amino acids 217 to 249 (33 residues), 21.6 bits, see alignment (E = 3.8e-08)
• PF00958: GMP_synt_C
  • amino acids 427 to 519 (93 residues), 129.3 bits, E=1.2e-41

Best Hits

Swiss-Prot: 98% identical to GUAA_BIFLO: GMP synthase [glutamine-hydrolyzing] (guaA) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 99% identity to bll:BLJ_0766)

MetaCyc: 51% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (5/8 steps found)
• superpathway of purine nucleotide salvage (9/14 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (520 amino acids)

>BBR_RS14405 glutamine-hydrolyzing GMP synthase (Bifidobacterium breve UCC2003)
MANGPVLVVDFGAQYAQLIARRVREAGVYSELVPHSMPVDEILAKDPKAIILSGGPASVF
EPGAPTIDTKVFESGVPVLGICYGFQVMAYELGGKVDKAALGEYGKTEAAIDDAEGILAD
SPAEQTTWMSHGVAVEQAPSGFTVLAHTEGAPVAAMADESRKLYGVQWHPEVKHSPLGQK
LIENFLHRCAALPNDWDASSIIEDQVKKIREKVGDAEVICGLSGGVDSAVAAALVHKAIG
DQLTCVFVDHGLLRKGEVEQVKHDFVAATGIKLITVDAADDFLKALKGVSEPERKRKIIG
EKFIRTFEKAQRQVLEEAGARGKEVKFLVQGTLYPDVVESGGGDGAANIKSHHNVGGLPK
DIKFQLIEPLRTLFKDEVRAIGTELGLPDEIVWRQPFPGPGLGIRIIGEITKERLDLLRE
ADAIAREELSKAGLDRDIWQCPVVLLADVHSVGVQGDERTYGSPIVLRPVSSEDAMTADW
SRVPYDVLATISTRITNECRQINRVVLDCTSKPPATIEWE