Protein Info for BBR_RS14400 in Bifidobacterium breve UCC2003

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 404 to 428 (25 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 380 (376 residues), 102.2 bits, see alignment E=3.1e-33

Best Hits

Predicted SEED Role

"putative acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>BBR_RS14400 acetyltransferase (Bifidobacterium breve UCC2003)
MKRFVGLDGIKGLALIAIVLYHCVQQKMPGGFYGVDVFFTVSGFLIAISLFRSLSTTGSL
NLRRYIPRRLVRLYPALLLLIPVIVSVCWLTERDLLVAIRNQVITVLFGCYNWYAIAGGQ
SYFEQTNPQILRHLWFIGVLTQFYIIVPFIAWAMWRIRDTRFASLIPLGLAALSGASMWL
MYKPGADPTRVYFGTDTHSVGLMLGVALAWWLTRHNQATPQAPRVAGAAADSGSVHVNIP
AIPNNIPNNIAEVAAKTTRQRLWETIAPAMSLTALVALIIMTVNGQQDNFAFRGGIIIAS
VLSVPLIAGTISDDSWMQDLMKFKPLAALGRYSYGIYLWHWPVWIIIQSTLPHMIQGPSY
SIILAITAILTALAVAFSWLMVEKTAAAQSALEVLVPYRNPVAKQIVCAVVVDIVWAVAL
VGCVQGLVHAPEKTSVQIQLEQQAQTLQQQKQSQQASQAQQTASDLMRSPTPPPAKPRHG
MPTGDQITAIGDSVMLASSQGLSAVFPGIQIDAAVSRSIMVAPGMVNNDLNAGTLRSWVI
LGLATNSAISTGQLDQLHNQIGPDRVLVLVNGHGDRSWIPVANQALSDYANTHQDNVVLA
DWDSAAQTNTQLLASDGIHPSAGTDLYAQTVKQAIEQWVQAGH