Protein Info for BBR_RS14395 in Bifidobacterium breve UCC2003

Annotation: ribose-phosphate diphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF13793: Pribosyltran_N" amino acids 15 to 130 (116 residues), 156.5 bits, see alignment E=3.7e-50 TIGR01251: ribose-phosphate diphosphokinase" amino acids 16 to 327 (312 residues), 364.1 bits, see alignment E=2.3e-113 PF00156: Pribosyltran" amino acids 172 to 267 (96 residues), 57.2 bits, see alignment E=2e-19 PF14572: Pribosyl_synth" amino acids 220 to 326 (107 residues), 78.2 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 97% identical to KPRS_BIFLO: Ribose-phosphate pyrophosphokinase (prs) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 97% identity to blo:BL0963)

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>BBR_RS14395 ribose-phosphate diphosphokinase (Bifidobacterium breve UCC2003)
MVSAILEGKPDKNLILVTGRVHPKLAQDVADQLGIDVLETTTYDFANGEMYVRYTESVRG
ADVFVLQSHYKPINKAIMEQLIMIDALKRASARSITAVCPLLGYSRQDKKHRGREPISCR
LVFDLLKTAGADRIMSVDLHAAQSQGFFDGPVDHLIAMPVLVDYIRDRFQGHLDNVAVVS
PDAGRIRVAEQWAQRLGGGPLAFVHKTRDITRPNQAVANRVVGDVAGKDCVLVDDLIDTA
GTIAGACHVLQEAGAKSVTVVATHGVLSGPAIDRLKESGAREVVLTDTVPIPEEKRWDGL
TVLSIAPLLASAIRAVFEDGSVAELFDTYPEHHGQGFLFA