Protein Info for BBR_RS14380 in Bifidobacterium breve UCC2003

Annotation: phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01515: PTA_PTB
  • amino acids 240 to 552 (313 residues), 392 bits, E=1.2e-121
• TIGR00651: phosphate acetyltransferase
  • amino acids 250 to 552 (303 residues), 376.8 bits, E=4.6e-117

Best Hits

KEGG orthology group: K13788, phosphate acetyltransferase [EC: 2.3.1.8] (inferred from 96% identity to blf:BLIF_0665)

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

• heterolactic fermentation (16/18 steps found)
• L-threonine degradation I (6/6 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• ethanolamine utilization (4/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• pyruvate fermentation to acetate I (2/3 steps found)
• pyruvate fermentation to acetate II (2/3 steps found)
• pyruvate fermentation to acetate VII (2/3 steps found)
• superpathway of acetate utilization and formation (2/3 steps found)
• sulfoacetaldehyde degradation I (1/2 steps found)
• mixed acid fermentation (11/16 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• sulfolactate degradation II (1/4 steps found)
• methanogenesis from acetate (2/6 steps found)
• superpathway of sulfolactate degradation (2/6 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (3/8 steps found)
• acetyl-CoA fermentation to butanoate (2/7 steps found)
• superpathway of taurine degradation (1/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (3/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (2/9 steps found)
• L-lysine fermentation to acetate and butanoate (2/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)
• gallate degradation III (anaerobic) (2/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (5/17 steps found)
• purine nucleobases degradation II (anaerobic) (8/24 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (5/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.8

Protein Sequence (556 amino acids)

>BBR_RS14380 phosphate acetyltransferase (Bifidobacterium breve UCC2003)
MTVTRVYIASPEGANGRNVVAYGVLNALTSKYKTMVFRPAVSNHDDFTPILLAASNAGLG
VALSTGLDVHKVRTDKDTARGDIVGAFNDAMDVSRADAALIVGTDKSHVNDPTSYEFNAN
VAADLKAGVFLAVCTIDRWPHELDETVHLSIEGMEAAGNKVLGIFVTGCEPRHAFSVKET
LAKYGLPVWTLPQIPFTDESTKDLALETFRKNAPTDEVFAALDVENTAPITPYAFQFDLL
GKAKSNKKTIVLPEGEEDRIIKAADYLLEREIVNLIIVGDKNAILARGEELGLKFLDRAR
FQAMDDENVLKPMVAKLCELRAKKGMTEEQARKQLADASYFGTMLVVLGYADGLVSGSIN
STANTVRPALQVIKTKPGQKLVSGAFLMCFKDHVAVFADCAINLNPDAEQLSEIALQSAE
TARAFGIDPKVGMLSYSTLGSGKGPDVDIVEEATKLLKEKAPDLPVVGSIQFDAAWSPDV
AATKAKGNDVAGHVNVFVFPDLCAGNIGYKAVQRSSGALAIGPVLQGLNKPVNDLSRGAL
VQDIINTIALTAIEAQ