Protein Info for BBR_RS14295 in Bifidobacterium breve UCC2003

Annotation: pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00224: PK
  • amino acids 1 to 327 (327 residues), 369.2 bits, E=1.9e-114
• TIGR01064: pyruvate kinase
  • amino acids 2 to 476 (475 residues), 490.8 bits, E=1.7e-151
• PF02887: PK_C
  • amino acids 358 to 474 (117 residues), 86.6 bits, E=1.3e-28

Best Hits

Swiss-Prot: 53% identical to KPYK_CORGL: Pyruvate kinase (pyk) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 97% identity to blj:BLD_0741)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• heterolactic fermentation (16/18 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• Entner-Doudoroff pathway I (7/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycolysis II (from fructose 6-phosphate) (8/11 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (15/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
• superpathway of hexitol degradation (bacteria) (9/18 steps found)
• glycerol degradation to butanol (7/16 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (6/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (13/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (12/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Protein Sequence (480 amino acids)

>BBR_RS14295 pyruvate kinase (Bifidobacterium breve UCC2003)
MRKAKIVDTIGPSTEDYDNLLKLVEAGMDVARLNRSHGTPEDHLNVYNNVRKASEATGRN
VAALVDLQGPKIRCGWFKKNAEGEDKVQLTLGQEFIITTDDVEGDEHITSTTFKGLPGDC
HPGDPILIDDGKVRLEVTKVEGNNVHTKVVVAGPVSSHKGINLPGVAVSLPALTEKDEAD
LRWAIRTGADIIAMSFVRFATDIDRAHEIMDEEGRRIPIVAKIEKPQALENLEEIVKTFD
GVMAARGDMAVECPLEEVPLATKRIIELARQYAKPVIVATEVLGSMVNSPVPTRAEASDC
ANAVLDGSDATMTSNETAVGKYPDVTVATMARISAYATDHGFDRIPELKNLDMSSTGAVS
SAAVDLADKLNAKAIVAYTQTGSTVHRVSRERPAAPIYGLTNNGHTYHWLALSWGTEAFL
LKEDYHDKSRKDLMIFTDKVLKDAGKVVDGDKIVILSSAQGDHQPGRTDSIYVHTVGACD