Protein Info for BBR_RS14290 in Bifidobacterium breve UCC2003

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 8 to 320 (313 residues), 371.8 bits, see alignment E=1.5e-115 PF03741: TerC" amino acids 71 to 273 (203 residues), 164.8 bits, see alignment E=8.8e-53

Best Hits

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 95% identity to bln:Blon_1746)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>BBR_RS14290 TerC family protein (Bifidobacterium breve UCC2003)
MAETPLAFEIITFVVLALFFIVDLFVIGRRPHVPSTKECVQHIAFFVVMALIFGGFIWFF
AGSKPAIEFYSGWLTEYSLSIDNLFVFVIIMSNFAVPKQIQKYVLSVGITIALIFRGLFI
LIGAALITRFTWVFFIFGAFLIYTALKLVLGGDEDEEYHENGIIRALRKVIKITDDYDGE
KLRTTKNGVRYWTPMLIVFLTIGTTDVMFAFDSIPAIFGLTKDPFLVFTSNVFALLGLQQ
LYFLLGALLDKLVYLPIGLSVVLGFIGVKLIMEALHGNTLPFINGGEGVHWVPEVPTWLS
LAVIVLAIGGAALASVVKMKQVESAEKA