Protein Info for BBR_RS14285 in Bifidobacterium breve UCC2003

Annotation: excinuclease ABC subunit UvrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 TIGR00631: excinuclease ABC subunit B" amino acids 12 to 692 (681 residues), 1059.5 bits, see alignment E=0 PF04851: ResIII" amino acids 23 to 93 (71 residues), 43.3 bits, see alignment E=1.1e-14 PF00270: DEAD" amino acids 24 to 90 (67 residues), 29.1 bits, see alignment E=2.3e-10 PF17757: UvrB_inter" amino acids 167 to 255 (89 residues), 118.8 bits, see alignment E=2.7e-38 PF00271: Helicase_C" amino acids 440 to 550 (111 residues), 70.4 bits, see alignment E=4.5e-23 PF12344: UvrB" amino acids 557 to 598 (42 residues), 75.2 bits, see alignment 8.8e-25 PF02151: UVR" amino acids 661 to 694 (34 residues), 38.6 bits, see alignment (E = 2e-13)

Best Hits

Swiss-Prot: 98% identical to UVRB_BIFLO: UvrABC system protein B (uvrB) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 99% identity to blf:BLIF_0646)

MetaCyc: 59% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (703 amino acids)

>BBR_RS14285 excinuclease ABC subunit UvrB (Bifidobacterium breve UCC2003)
MGFNIERADKPFVVKSPYQPSGDQPQAITELSERIENGENDVVLMGATGTGKTATTAWLI
EKLQRPTLIIEPNKTLAAQLCAEFRELMPDNAVSYFVSYYDYYQPEAYIPQTDTYIEKDS
NINDDVERLRHQATANLLTRRDCVVVATVSCIYGLGTPEEYAGRMLFLKVGQEINRDDLL
RQFVAMQYKRNDIAFTRGTFRVRGDTVEIIPVYEELAVRIEFFGDEIDRISTLHPLTGDE
IDEENEVHIFPASHYVAGPERMERALKTIREELDERLAELRKQGKELEAQRLNMRTTYDL
EMLTQVGVCSGVENYSRHFDGRAAGTPPHTLLDFFPDDFLLVIDESHVTVPQIGAMYEGD
ASRKRTLVEHGFRLPSAMDNRPLKWPEFLQRVGQTVYLSATPGDYELGLSDGVVEQIIRP
TGLLDPKIDVRPVKGQIDDLLGEIKARVDRNERALVTTLTKKMAEDLTDYLLERGIKVEY
LHSDVDTLRRVELLRMLREGKIDVIVGINLLREGLDLPEVSLVAILDADKEGFLRSYRSL
IQTIGRAARNVSGTVIMYADETTDAMRKAIDETDRRRAKQIAYNKEHGIDPKPLIKKISD
VNDMLAKEDVDTQTLLEGGYRNAGKAGNTHLGVPVLDPNEADKRHEEILKAGLPAQDLAD
LIRQLSEQMHTAAEQLQFELAARLRDEIRDLKKELRQMTEANK