Protein Info for BBR_RS14275 in Bifidobacterium breve UCC2003

Annotation: 30S ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF00575: S1" amino acids 35 to 105 (71 residues), 52.3 bits, see alignment E=9.2e-18 amino acids 121 to 188 (68 residues), 57.6 bits, see alignment E=2e-19 amino acids 206 to 277 (72 residues), 93.5 bits, see alignment E=1.2e-30 amino acids 293 to 363 (71 residues), 83.8 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 70% identical to RS1_MYCTU: 30S ribosomal protein S1 (rpsA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 98% identity to bln:Blon_1754)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>BBR_RS14275 30S ribosomal protein S1 (Bifidobacterium breve UCC2003)
MAENNIEVTKVAINDIGTEEDFIKAVDSTIKNFDDGDLVEGTVVKIDHDEVLLDIGYKTE
GVIPSRELSIKKDVDPDEVVEVGDTIEALVVTKEDKEGRLILSKKRAQYERAWGDIEKIK
EADGVVEGTVIEAVKGGLIVDIGLRGFLPASLVEMRRVRDLSPYIGQKIKAKILELDKNR
NNVVLSRRQYLEETQSEVRETFLSQLKKGQIREGVVSSIVNFGAFVDLGGVDGLIHVSEL
SWKHIDHPSEVVKVGDKVTVEVLDVDLDRERISLSLKATQEDPWQRFARTHVPGQIVKGK
VTKIVQFGVFISVEDGIEGLVHISELANRHVENPETVVKPGETVFVKVIDVDLDRRRISL
SLKQANDSVDPASEDFDPAIYGMPAEYDEQGNYKYPEGFDPNTNEWIAGYEKQREEWEAQ
YAAAHDLWEEHKEFVAKELANAAESAAADGQNQKEEKPVEETSNYSSAAPATGTLADSDQ
LAALRDQLLGK