Protein Info for BBR_RS14265 in Bifidobacterium breve UCC2003

Annotation: Solute-binding protein of ABC transporter system for metals

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF01297: ZnuA" amino acids 51 to 305 (255 residues), 140.4 bits, see alignment E=4.2e-45

Best Hits

KEGG orthology group: K02077, zinc/manganese transport system substrate-binding protein (inferred from 70% identity to blm:BLLJ_0627)

Predicted SEED Role

"Zinc ABC transporter, periplasmic-binding protein ZnuA" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>BBR_RS14265 Solute-binding protein of ABC transporter system for metals (Bifidobacterium breve UCC2003)
MGIRITRLTKLAAAGLGAVMLFASAACGSATTQTEPNTKQNVPEPTGPINVVASINQWGS
LAAELGGDDVTITSIMNSTNVDAHDFEPKTSDVAKLSQAQIVVANGAGYDSWATKPLSKS
STLVSAASVMGAMEGDNPHLWFSKDARSSMASAITEAYVKALPSKKRIFQKRLKNWLNSE
KTLETWVNDFTKTHTDLTYAATEPVAYYLMADVGFKNATPKGYTQSTASGGEPAPADLQA
FQTLIEDKGADVLINNTQEASDATNMITGTAGKSDVPVVDVSEQMPADATTLNAWINQLI
NTIIDAVDPTYGCDAGTGDNTEGDASGENSSDTAANQSDSANDAGTTYIRECKATNADSA
SDSANFGTDNSTTDTEGTTPSNEGQTDPGK