Protein Info for BBR_RS14220 in Bifidobacterium breve UCC2003

Annotation: phosphomannomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01484: HAD hydrolase, family IIB
  • amino acids 23 to 244 (222 residues), 59.4 bits, E=2.8e-20
• PF08282: Hydrolase_3
  • amino acids 23 to 227 (205 residues), 26.4 bits, E=5.7e-10
• PF03332: PMM
  • amino acids 136 to 260 (125 residues), 36.9 bits, E=3.6e-13

Best Hits

KEGG orthology group: K07024, (no description) (inferred from 73% identity to blf:BLIF_0632)

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen degradation I (7/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• D-galactose degradation I (Leloir pathway) (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• starch degradation III (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• chitin biosynthesis (5/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• colanic acid building blocks biosynthesis (4/11 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.2

Use Curated BLAST to search for 5.4.2.2

Protein Sequence (267 amino acids)

>BBR_RS14220 phosphomannomutase (Bifidobacterium breve UCC2003)
MVVRSWAELDLDDICAHARVFGFDLDNTLASSKQPMEPAMIARFSALTAHATVALISGGG
MDVVTSQVLDVLGPDADRGHLHVMPTSGSRYYRWDGGRWTLVYAHDLDDRTVAAITSSLE
RRAKELGMWEEHVWGSRIENRGSQITFSALGQYAPVAVKQSWDPDNIKKRTLVEAVKADL
PDLRVRSGGYSSVDVSKHGIDKAYAVRRLAEILDVPVGNIVFVGDRMTPDGNDYPAVAAG
AVGMKVENPQDALGLMDALLQRVGASA