Protein Info for BBR_RS14170 in Bifidobacterium breve UCC2003

Annotation: hemolysin III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 101 to 122 (22 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details PF03006: HlyIII" amino acids 95 to 294 (200 residues), 177.1 bits, see alignment E=2.3e-56

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 91% identity to bll:BLJ_0693)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>BBR_RS14170 hemolysin III (Bifidobacterium breve UCC2003)
MAATQQTNSEAVNEPSDSYVETKRQAVIEAREQALQAKAEAVRVKAQFRAEAIRAKAEEK
ASRTLAKAENRALKIEGIAPAEVERKIRLDVHGRPKPAMRGWIHAVAAPLSLAAGIVLIC
LAHGASLKWACAVFMTSSLVLFTNSACYHLGDWSPRVTDVLRRIDHVNIFLLIAGTYTPV
SFALEPFWRNIIIISMWACTVIAIIIHVIWINAPRWLYTVVYIIFGIYGLAYMVMFWNSP
YAGPAVVVLLCSGGACYILGAIVYALRKPDPWPRVFGFHEIFHCGTVAGYACHMVAIYMV
IVALWH