Protein Info for BBR_RS14155 in Bifidobacterium breve UCC2003

Annotation: L-serine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR00720: L-serine ammonia-lyase" amino acids 2 to 482 (481 residues), 635.5 bits, see alignment E=2.5e-195 PF03315: SDH_beta" amino acids 3 to 154 (152 residues), 196.3 bits, see alignment E=4.1e-62 PF03313: SDH_alpha" amino acids 205 to 479 (275 residues), 298.7 bits, see alignment E=4.4e-93

Best Hits

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 86% identity to bln:Blon_1778)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>BBR_RS14155 L-serine ammonia-lyase (Bifidobacterium breve UCC2003)
MFSVLDMFTIGVGPSSSHTVGPMAAAYAFSSSLQQKHVLNRVTRVKTTLYGSLALTGLGH
GTDRAVMAGLEGNVPATVDTDHMLHIRETCALDNTLNLAGAKRIHFDYDHDVIFEQWKRM
AAHPNGMRFQAFDDAANLVDEQVWYSIGGGFIRQGAPDDSMIGIHDRPPAGTSFADEDES
AVEPVTEVPYPFHSCTELVALCRRHDMSIADIVWANETALRPEEAVKAELDGIWQVMRDC
VSHGCTSKETVLPGGLDVPRRAPKMYQRLAFNSDVLRRNSRRKDAVLESSDAAWVDLFAL
AVSEENAGGGRIVTAPTNGAAGIIPAVLHYYWHFVDDADDQGVSTFLLTAGAIGYLFKRN
ASISGAEVGCQGEVGSACSMAAAGLAAVMGGTPEQVENAAEIGIEHNLGLTCDPVGGLVQ
IPCIERNAMAANTAINAVRMAMLGDGSHIVTLDQAIATMKQTGEDMMAKYKETSKGGLAV
NVVEC