Protein Info for BBR_RS14125 in Bifidobacterium breve UCC2003

Annotation: phosphopyruvate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03952: Enolase_N
  • amino acids 4 to 134 (131 residues), 189.6 bits, E=2.4e-60
• TIGR01060: phosphopyruvate hydratase
  • amino acids 4 to 424 (421 residues), 630.4 bits, E=6.4e-194
• PF00113: Enolase_C
  • amino acids 140 to 424 (285 residues), 407 bits, E=4.7e-126

Best Hits

Swiss-Prot: 99% identical to ENO_BIFLS: Enolase (eno) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 99% identity to bln:Blon_1836)

MetaCyc: 57% identical to enolase subunit (Lactiplantibacillus plantarum)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• Bifidobacterium shunt (15/15 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• Entner-Doudoroff pathway I (7/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycolysis II (from fructose 6-phosphate) (8/11 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• gallate biosynthesis (2/3 steps found)
• glycolysis IV (7/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• quinate degradation I (1/3 steps found)
• quinate degradation II (1/3 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• gluconeogenesis III (7/12 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• gluconeogenesis I (7/13 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (15/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
• superpathway of hexitol degradation (bacteria) (9/18 steps found)
• formaldehyde assimilation I (serine pathway) (5/13 steps found)
• glycerol degradation to butanol (7/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (7/18 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (13/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (12/26 steps found)
• superpathway of chorismate metabolism (32/59 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (2/35 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (16/56 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (3/42 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.11

Protein Sequence (432 amino acids)

>BBR_RS14125 phosphopyruvate hydratase (Bifidobacterium breve UCC2003)
MAAIESVYARQILDSRGNPTVEVYLETEDGAQGKGLVPSGASTGEAEAWERRDGDKSVYG
GKGVLNAVKAVNEVIAPKIIGMDAADQRALDDLMIELDGTPNKGKLGANAILGVSLAALY
ASAESAGLPLYRYIGGTNGHILPVPNMNIMNGGAHADFATDIQEYMISPYGFDTYSEALR
AGVEVYHTLKNVLKKEGLNTGLGDEGGFAPKMKSNEDSLKYIMDAISAAGYEPGKQIGIC
LDVASSEFYNKETGKYRFDGEERDSAYMLDYYENLINEYPIVSIEDPFNEEGWEDWAAIT
ARLGDRLQFVGDDLLVTNPARLQKAIDLGAANSLLVKLNQIGSVTETLDAIELATANGYT
SMVSHRSGETPDTTISDLAVAKNTRQIKTGAPARGERVAKYNRLLEIEEELGSTAQYAGY
SAFKACKKYLAK