Protein Info for BBR_RS14120 in Bifidobacterium breve UCC2003

Annotation: aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF00248: Aldo_ket_red" amino acids 16 to 300 (285 residues), 244 bits, see alignment E=8.9e-77

Best Hits

KEGG orthology group: None (inferred from 90% identity to blb:BBMN68_772)

Predicted SEED Role

"Predicted oxidoreductases (related to aryl-alcohol dehydrogenases)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>BBR_RS14120 aldo/keto reductase (Bifidobacterium breve UCC2003)
MKNQHTATLAGYEIPRLGMGTMALAIEGRPTNRNQAIETIHAALDAGVRYFDTAWSYYLP
SKPGTGEPEDMGYGEYLVRDALNSWHGPKDEVLVATKTGWLRTLDNHGNYSWQADARPET
MIANAKESARRLGVETLDLLYSHCNDPQVPYEDQMGALKQLVDEGVVRAVGISRIDNKDI
EIAHTILGDRLVAVQNQFSPVHRDPDHTMETCEQLGLAFVCWSPLGGFLDPFNEHLFDRF
KEVADNHGCSYQRVTLAWELAQYGNLFTIPSARNPQEIQDSFKAVTLELSDSEIDYLNDV
ISA