Protein Info for BBR_RS14110 in Bifidobacterium breve UCC2003

Annotation: aminoacyl-tRNA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 98% identical to PTH_BIFLD: Peptidyl-tRNA hydrolase (pth) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K01056, peptidyl-tRNA hydrolase, PTH1 family [EC: 3.1.1.29] (inferred from 97% identity to blm:BLLJ_0597)

Predicted SEED Role

"Peptidyl-tRNA hydrolase (EC 3.1.1.29)" (EC 3.1.1.29)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>BBR_RS14110 aminoacyl-tRNA hydrolase (Bifidobacterium breve UCC2003)
MASDFWLIAGLGNPGKKYEDTRHNMGFMTADVLAERWSVNFADHKGLAMLGKSTMNLDGR
TIKFFLAKPLTYMNDSGNAVASISAYYQIEPDHIVVIHDDMDLEFGRIKVKAGGSAGGHN
GIKSIDRSLGTPKYARVRMGVGHSKRGAHAHDNTVNWVLGGFGPDQRKQLPEFLADGADA
AEEIIFHGLAKTQEKFNGR