Protein Info for BBR_RS14075 in Bifidobacterium breve UCC2003

Annotation: glutamate-5-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF00171: Aldedh" amino acids 15 to 298 (284 residues), 60 bits, see alignment E=8.4e-21 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 22 to 420 (399 residues), 461 bits, see alignment E=1.6e-142

Best Hits

Swiss-Prot: 94% identical to PROA_BIFLS: Gamma-glutamyl phosphate reductase (proA) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 94% identity to bll:BLJ_0672)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>BBR_RS14075 glutamate-5-semialdehyde dehydrogenase (Bifidobacterium breve UCC2003)
MSDELSPEVFDAVCRQADQAVSAQQRLAQANTEAKNELLLAIADALDEHAADIEAANALD
MLESKENGMDAGKLDRLLFDTPRVAAAAQDVRHVATLPDPVGEIVRGYNLPNGLRLTQTR
VPMGVIGMIYEARPNVTVDVASLCLKSGNAALLRGGHAAERTNAATLSVIAPVLEAHGFD
PALVQSVDQYGRAGATAMMEARGHIDVLVPRGGAGLIQAVVRNSKVPVIETGAGNVHIYI
DRSADLVKAIPIVLNAKTQRVGVCNAAEKLLVHEDVAAEFLPQIAAALTQANVVLQADET
SYDILEGAAIEGLELNHATEEDWDTEYLALKMGIKVVPSLESAIDHINIHSTGHTESIIA
EDYAAIEEFTKRIDSAVVMVNASTRFTDGGVFGFGAELGISTQKMHARGPMGLREMTTTK
WIGYGTGQVRA