Protein Info for BBR_RS14060 in Bifidobacterium breve UCC2003
Annotation: ABC transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 96% identity to bll:BLJ_0664)Predicted SEED Role
"FIG00424305: hypothetical protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-positive bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (237 amino acids)
>BBR_RS14060 ABC transporter (Bifidobacterium breve UCC2003) MNWKSVVKQCRFDCVGMGLFSVANMVFLLVLPVLSIVVSLAMISTHVDEHVASGLMGGLG GLASTMACMSALGPTSSEESAGHSAMRGLIPVSRTAQVVGRYLFLLVVGLLWALDVVICG GVFIVFGDIADMGWIGTLAAGAFIFALAIILGSVLLACAYRFTFRKMMVASVAVMVGLYA VIALLARLPVDWQWLLLNITDFLTIWWHTALVLAVLCLLAYFGSMLIAIRIYRAKEL