Protein Info for BBR_RS14035 in Bifidobacterium breve UCC2003

Annotation: HAD family phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00702: Hydrolase" amino acids 3 to 179 (177 residues), 86.7 bits, see alignment E=4.2e-28 PF12710: HAD" amino acids 5 to 134 (130 residues), 32.3 bits, see alignment E=2.1e-11 PF13419: HAD_2" amino acids 6 to 184 (179 residues), 86.1 bits, see alignment E=5e-28 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 80 to 182 (103 residues), 44.9 bits, see alignment E=1.4e-15

Best Hits

KEGG orthology group: None (inferred from 90% identity to blf:BLIF_0596)

Predicted SEED Role

"FIG00672540: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>BBR_RS14035 HAD family phosphatase (Bifidobacterium breve UCC2003)
MTKAAIFDLDGTLLDSMGVWDQVDIDFLGKRGIEVPPDYMIKVSSMQFRQIAEYTIARFG
LKDTPEGLMQEWDDMVRVAYSTTVEAKPGALDYLRDLKSAGVKMGVATSLPPQLREPALR
HVGMLDLFDDIVSVDDANDVGKDQPDVYLLAAERLGVKPVDCTVFEDLLVGIKSAKSVGM
KVWAMHDDSSDADWPEICDIADGVLFDFHDAPRPL