Protein Info for BBR_RS14025 in Bifidobacterium breve UCC2003

Annotation: NAD kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF01513: NAD_kinase" amino acids 53 to 114 (62 residues), 66.8 bits, see alignment E=2.4e-22 PF20143: NAD_kinase_C" amino acids 140 to 266 (127 residues), 106.1 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 94% identical to NADK_BIFLS: NAD kinase (nadK) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 95% identity to blf:BLIF_0594)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>BBR_RS14025 NAD kinase (Bifidobacterium breve UCC2003)
MAKRNAVVVTHTRLRQSGTVVSEAVSQLRSAGFEVAIIDNTEAPDFGVSPACVTDDTEIV
VVLGGDGTILRAAELVHCTQVPILGVNMGHVGFLAEFESFQIDEAIRRVAEHDYSIDERM
IAHVDVWLPGATKPIEDWALNDITLERADRGKMVELSIRVDDVEMNSFGADGIIVSTPTG
STAYAFSAGGPVIWPNVKALQLIPLAAHALFARPLIIGSGSTFTIDILDDSMSEGWICCD
GRRQRALPQGTRVMVRESRDTLRLARLSGVPFTNRLVSKFDLPVVGWREHARNEASGQPL
HHGHTFPTAADAVSDRADEHNGKAEG