Protein Info for BBR_RS14020 in Bifidobacterium breve UCC2003

Annotation: TrkA family potassium uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF02080: TrkA_C" amino acids 75 to 137 (63 residues), 36.5 bits, see alignment E=1.8e-13

Best Hits

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>BBR_RS14020 TrkA family potassium uptake protein (Bifidobacterium breve UCC2003)
MSVEASVTITGNLLDAGISDLWAKSVSQKHARILQRIGAHHIINAETDAGKRVGHLAAGN
YLDYIEIDGPYNVVKIHTPLYAVGRNIEDVQVHDKYGVTVVGIKAPGKEFQYGSKELIMH
RNDELIIMGKQDQIDRFIQG