Protein Info for BBR_RS13990 in Bifidobacterium breve UCC2003

Annotation: DUF975 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 139 to 164 (26 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 258 to 283 (26 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details amino acids 462 to 479 (18 residues), see Phobius details amino acids 487 to 508 (22 residues), see Phobius details amino acids 528 to 553 (26 residues), see Phobius details amino acids 564 to 583 (20 residues), see Phobius details PF06161: DUF975" amino acids 147 to 301 (155 residues), 66.5 bits, see alignment E=3.4e-22 PF06541: ABC_trans_CmpB" amino acids 430 to 584 (155 residues), 149.7 bits, see alignment E=7.4e-48

Best Hits

KEGG orthology group: None (inferred from 57% identity to bde:BDP_1286)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>BBR_RS13990 DUF975 domain-containing protein (Bifidobacterium breve UCC2003)
MQRKTLKAEARKTLKRHYWLLVIVCLFAAFLSADYGSSPAALNTNMNPNAASQEASRTGE
SNTGASDSFGLLLQMASGDANGARDRVRDNERTIANQDTVATLGRTRGVLSAVVNSLSTG
SFLLPVTDATASIIRSESIAIAILVIVALLVTLTAGLFVTEVFRVVLRRIVLESRTYDKV
PLRRFLYPLQTGCWVRMAWVLLVENVYRLLWWCTVVGGIVKTYSYFLVPYIVAENPNISA
NEAISLSRRMMKGHKWECFVAQLSFLGWYLLSIATFGLSAIFYSNGYNAAFFAEYYVKLR
ATAKSAGIKGSEWLCDEYLYAKPSPELLNDTYADVVRGAATIYAGGATVSAPTGFAGWMS
DWFGITIRQDDRVDAWQQYESDLDSMAKAEDILHGLTYPGRLAPAAMDFRLAKRMNLNPQ
RSYTVLNLVMMFFIFCFVGWVWEVTLALITEGMFVNRGTLHGPWLPIYGTGGIIILILLK
KLRPHPALLFVGTVVLCGCLEYFSSWYLELTHDGQRWWDYTGYFLNLNGRICAEGLLAFG
LGGLATVYLLAPALDNLLARAHRRIMAVVAIVLLVAYVGDNIYSSIVPNTGAGITDYKGS
SSSAES