Protein Info for BBR_RS13985 in Bifidobacterium breve UCC2003

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details PF06541: ABC_trans_CmpB" amino acids 10 to 163 (154 residues), 176.4 bits, see alignment E=2.2e-56

Best Hits

KEGG orthology group: None (inferred from 88% identity to blb:BBMN68_803)

Predicted SEED Role

"FIG028593: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>BBR_RS13985 membrane protein (Bifidobacterium breve UCC2003)
MMIALEHYFLWFLFYSFVGWVYESILVSCQERRLVNRGFLNGPLCPIYGTGAVLGIAVLG
NLHNPIIIFLISMVGATILEYTTSWVMEELFHARWWDYSNFRFNVQGRVCLLGAVIFGIA
GVVIVLGAQPYVAQFTDLIPVPMLHTLVTVLALVTIIDLAVTVAGMLEFEQVLDSVTQTV
QDVAARAGDTWQWGSSAVSDKMRELSQDTIERLRWAANGVINAQQKRMLKSFPKFQVPDR
QDIIDSLRELMGPRR