Protein Info for BBR_RS13965 in Bifidobacterium breve UCC2003

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF05690: ThiG" amino acids 43 to 283 (241 residues), 324 bits, see alignment E=3e-101

Best Hits

Swiss-Prot: 99% identical to THIG_BIFLO: Thiazole synthase (thiG) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 99% identity to bll:BLJ_0645)

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>BBR_RS13965 thiazole synthase (Bifidobacterium breve UCC2003)
MGNINPVTEASVEATPLPPQPAVTNPVGTAAPILPVEDKPLNLGGHEFQSRFILGSGRYD
LNLIKATVEHAGTQIVTMALRRAQTTENSVLDYIPEGITLLPNTSGARNAEEAVRIARLA
REVCHTDFVKVEIEHETKYLLPDNAETIRATEMLAREGFVVMPYMFPDPIAARQLEEAGA
AAVMPLGSLIGSNMGLRMRDFIEIIIANAHVPVIIDAGIGRPSQACDAMEMGADAVMAYT
AVASAGNIPLMAEAFKHAIDAGRAAYLSGLGKVTEGQAVPSSPTTGYLH