Protein Info for BBR_RS13910 in Bifidobacterium breve UCC2003

Annotation: arginine repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01316: Arg_repressor
  • amino acids 13 to 76 (64 residues), 69.6 bits, E=1.5e-23
• TIGR01529: arginine repressor
  • amino acids 17 to 157 (141 residues), 130.9 bits, E=1.9e-42
• PF02863: Arg_repressor_C
  • amino acids 101 to 158 (58 residues), 76.4 bits, E=1.2e-25

Best Hits

Swiss-Prot: 89% identical to ARGR_BIFLS: Arginine repressor (argR) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K03402, transcriptional regulator of arginine metabolism (inferred from 89% identity to bln:Blon_1876)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Protein Sequence (170 amino acids)

>BBR_RS13910 arginine repressor (Bifidobacterium breve UCC2003)
MSEALPSLQRPATRAARLSAIEQALATHVITSQSQLSKILLDEGIAVTQATLSRDLDEMH
AVKTRLKDGTVAYTVGRGSAVADVEDVGERTEAQMARVLNGLVTSVAAARNLVVVHTPSG
AAQYVASVIDRQPIDGVLGTIAGDDTVMVICADDGTAVSRSDWLLGLASK