Protein Info for BBR_RS13905 in Bifidobacterium breve UCC2003

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 6 to 144 (139 residues), 144.5 bits, E=2.6e-46
• TIGR00658: ornithine carbamoyltransferase
  • amino acids 6 to 309 (304 residues), 370.8 bits, E=2.5e-115
• PF00185: OTCace
  • amino acids 153 to 308 (156 residues), 189.5 bits, E=4.2e-60

Best Hits

Swiss-Prot: 96% identical to OTC_BIFLS: Ornithine carbamoyltransferase (arcB) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 95% identity to blo:BL1060)

MetaCyc: 47% identical to ArgF (Bacillus subtilis)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
• urea cycle (3/5 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)
• superpathway of arginine and polyamine biosynthesis (8/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (321 amino acids)

>BBR_RS13905 ornithine carbamoyltransferase (Bifidobacterium breve UCC2003)
MTPELRHMLRDDDLNHEEQKQVLELAIKFSKNRFYKQPFAGPQAVAVLFDKPSTRTRSSF
SIGVAELGGYPLVIDKSGSQLGRGEPVADTARVLDRMAYGVVWRTFGQDRVEEMAKYSTH
PVVNALTDDFHPCQILADFQTIAEHRGGVDNLKNQTIAYLGDAANNMSNSYLLGGAVAGM
NVRVAGPQGYLPRPDIVADAERIAAENGGSILVTTDAREAVAGADCVFTDTWVSMGEEAE
YAIRSKPFWDYQVNAELMALAKPDALFQHCLPAYRGKEVTAEVIDGPQSVVWDEAENRLH
AQKALLTWLTGKARGDESLLA