Protein Info for BBR_RS13890 in Bifidobacterium breve UCC2003

Annotation: bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00120: glutamate N-acetyltransferase/amino-acid acetyltransferase
  • amino acids 2 to 390 (389 residues), 345.1 bits, E=2.5e-107
• PF01960: ArgJ
  • amino acids 11 to 391 (381 residues), 434.1 bits, E=2e-134

Best Hits

Swiss-Prot: 94% identical to ARGJ_BIFLO: Arginine biosynthesis bifunctional protein ArgJ (argJ) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00620, glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC: 2.3.1.1 2.3.1.35] (inferred from 94% identity to bll:BLJ_0637)

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• L-ornithine biosynthesis I (4/5 steps found)
• superpathway of arginine and polyamine biosynthesis (8/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.35

Protein Sequence (391 amino acids)

>BBR_RS13890 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ (Bifidobacterium breve UCC2003)
MSVTFAQGFSAAGVVAGISSVEGKKDLALVVNNGPLDAVAGVFTSNRFCAAPVQWSRKAV
ADGHAKAVILNSGGANACTGEAGYQQSVSTAEAVAELVGAQAEDVAVCSTGLIGELLPLD
NVLAGAKAAYAALAGTAEAGADASHAIMTTDTKPKTVELTGSNGWKIGGMVKGSGMIAPQ
LATMLCVITTDAVVSAGQMQAALTVAAEHSFNRIDVDGCMSTNDTVLLLASGASGVEPDK
DEFNKLVREACASLSRQIIGDGEGASHDIRITVTGATSEDAALACGRAVAASNLLKCAIS
GNDPNWGRIVSSLGTVSPEVAPYDSEKVTVDVNGVRICENGGAGRDRSEVDMTPREVHID
IDLNTGSNAEATVWTDDLTHEYVHINADYES