Protein Info for BBR_RS13855 in Bifidobacterium breve UCC2003

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 25 to 172 (148 residues), 83.8 bits, E=5.5e-27
  • amino acids 289 to 440 (152 residues), 100.2 bits, E=4.8e-32

Best Hits

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 92% identity to blf:BLIF_0565)

Predicted SEED Role

"Duplicated ATPase component YkoD of energizing module of thiamin-regulated ECF transporter for HydroxyMethylPyrimidine" in subsystem ECF class transporters

Protein Sequence (490 amino acids)

>BBR_RS13855 ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MQVDPAAVEASGWGWRHATRKDFALRAVDFTIRPGERVLLLGASGAGKSTMMAGLAGVLG
GDEEGEQEGSLTIDGVDAREARGRVGLVLQDPDSQIILERLGDDAAFGCENLNVPREEIW
QRVRESLDMVGLGGLELGRSTRHLSGGQRQRLALAGVLAMKPGLLLLDEPTANLDPEGVI
EVHDAVKKVIETTGQTMVVVEHHIDVWLDLVDRVIVLGRPDADSPAGAVIADGKPDEVFA
QMGDVLAAGGAWVPGRAIPDYRPDDETRGETVLSTENLSFGRGTALGTGINLDFHAGEVT
ALMGPNGAGKSTMALTLAGLLKPIDGKVLIADSLKPPHAGQEPINWKSKELLGRIGMVFQ
EPEHQFASNFVRDEVAIGPKSMGHSEDEAYQTADRMLDQMNLTRFAKANPYTLSGGEKRR
LSVASMLAAAPKVLVMDEPTFGQDFSTWTEMVKLIAAIRDQGSCVIMVTHDEALVDALGA
RRVMFEETRA