Protein Info for BBR_RS13835 in Bifidobacterium breve UCC2003

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF07992: Pyr_redox_2" amino acids 5 to 351 (347 residues), 194.3 bits, see alignment E=1.4e-60 PF00890: FAD_binding_2" amino acids 6 to 42 (37 residues), 24.2 bits, see alignment 8.8e-09 PF12831: FAD_oxidored" amino acids 6 to 52 (47 residues), 31.2 bits, see alignment 6.8e-11 PF01134: GIDA" amino acids 6 to 57 (52 residues), 24 bits, see alignment 9e-09 PF13450: NAD_binding_8" amino acids 9 to 44 (36 residues), 25.8 bits, see alignment 4.8e-09 PF00070: Pyr_redox" amino acids 202 to 271 (70 residues), 64.3 bits, see alignment E=5.3e-21 PF02852: Pyr_redox_dim" amino acids 371 to 485 (115 residues), 73.7 bits, see alignment E=6.2e-24

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 86% identity to blf:BLIF_0561)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>BBR_RS13835 FAD-dependent oxidoreductase (Bifidobacterium breve UCC2003)
MNEQFDLAIIGAGPGGYSTALRAAELGMSVALIERDATVGGTCLNRGCIPSKALITATRT
IDTVHRAAELGVNASVNGIDFGTLRDYRLRVVDTMVKGLAGLLAHRNITVLRADASFNAE
ETDAADNARHIVHLAPSPGQTEILTYHKADVPEPTDASLDLAAGNVVIATGAKPRPLPGN
PFAGALIDSTQALEVNEFPSSAVIIGAGAIALEFASMWNAAGSQVTLLIRKNRVLSTWDR
RAGTTLTRELKRRGVNVITHTIVTHVDTGANLGATVHYTREGQDSEQSVWGEIALAAIGR
TPVADPSWGVALTESGHVATDAFGRTNKSGIWAVGDVTPGHALAHRAFEQGIVIAETIAG
LNPKPVDENTVPQIVFSSPEAASVGLTIEQAQARENLLEVKETIYPMLANARMLMSGTAG
SLTIVSGCDAADPDTPRVLGVHMVSPVASDIISEAEQLVGNRLPLADAARLIHPHPTFSE
TLGEALLKADDRPLHTR