Protein Info for BBR_RS13820 in Bifidobacterium breve UCC2003

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 188 to 202 (15 residues), see Phobius details PF01883: FeS_assembly_P" amino acids 8 to 82 (75 residues), 50.3 bits, see alignment E=3.5e-17 PF10609: ParA" amino acids 123 to 352 (230 residues), 236.1 bits, see alignment E=6.3e-74 PF01656: CbiA" amino acids 126 to 163 (38 residues), 41.7 bits, see alignment 1.7e-14

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 94% identity to blj:BLD_0067)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>BBR_RS13820 ATP-binding protein (Bifidobacterium breve UCC2003)
MSDARQIEAEIYERLSKVIDPELGRSVTDLGMIAAIEATPADANVDTDSYDVTVHVELTV
PGCPLSETITNQINGAVSSYPGAQLNTHIEVGSMSRDKLADLVADLKAERKQNPFSKPGV
KTRIFAITSGKGGVGKSSVTANLAATFAALGYDTAAIDADIYGFSLPRLFGVHTQPTNLN
GMLMPVTAWGVKLISIGMFAGADRAILWRGPRLQRSLEQFLSDVWWGEPDVLLLDLAPGT
GDMAISVAQALPNAELVVITTPQPSASDIAVRSGLVALQVPVKVRGVVENMSYYEHKGEK
LEIFGAGGGQRVAEQLTEALGYDVPLMAQLPLEPEVRETGEAGRPAVLTSEGALRTDGIG
QTFRGLAERLMAL