Protein Info for BBR_RS13805 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 749 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 412 to 429 (18 residues), see Phobius details amino acids 458 to 486 (29 residues), see Phobius details amino acids 507 to 527 (21 residues), see Phobius details amino acids 592 to 615 (24 residues), see Phobius details amino acids 627 to 646 (20 residues), see Phobius details amino acids 652 to 672 (21 residues), see Phobius details amino acids 705 to 726 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 76% identity to blj:BLD_0064)

Predicted SEED Role

"FIG00424960: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (749 amino acids)

>BBR_RS13805 hypothetical protein (Bifidobacterium breve UCC2003)
MHSEDSHLTSRVHRRLSWRPLAALLAVAAIIVGMECIVFNLPFWRTLGASTDTNAVHNTL
GPGLVRTDDDMLTVTDPTKAYLELAADGTSAYLRIDSPSHDTIDAVHEQAEAESRANGDK
AVFKPLDTIHVRVDVNGSTGQAISMNPGTSRSHYVKAVGAGTVRIWIQEERGAIVPITDA
RANVHVPFAIDWIRVAAMAALALLVAIWRPGSRLWRITFDPSSTRQRLAFGAIAAIPTLA
IGASIIWQLTHAMPLAFHTADGYTYDFDQYGHVADSLIAGRPWLDLDVPGQLAQSTHPYD
VPTRLKLLEDGVSPMYWDYAYYEGHWYSYFGVLPAVLLFVPYRLITGHMLPTAAAEQFLV
LLFIIFFSLLVLRVIHRVMPKTSLAAASLITVSALLGAQVGYLAYRTNFYQVPFAASLAL
TSLGLWFWLGADTSSRPLIPSDRWQAGDAQPLSLPRLAVGALCIAANFGCRPTFALTALL
AIALFWPQIRAMISDLAHRRITMLKALRAPLAMVIPALVVVIPLMLWNKVRFGSLIDFGN
AYQFTVSDMTRYATPIADMPATVWYYLFLPVRFVRNFPWLAVSPAPMPVWGYYEVMVGAL
FTATPLMLLALVLPFLHKLEMHGMRRWLMSCLALAGVLVVFDSYVGGLGWRYLADFGWLV
ALASIPGLLWLVNGREPSTSLAGANDAASGDGIARVTPWRWLMRWTVLIVLIWTLAVAIL
GCFAPARDDAMLTNNAALWHQVQSWFTLL