Protein Info for BBR_RS13780 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 221 to 247 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 74 to 246 (173 residues), 81.9 bits, see alignment E=2.5e-27

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 81% identity to bbi:BBIF_0224)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>BBR_RS13780 ABC transporter permease (Bifidobacterium breve UCC2003)
MNNLKSWLVRIAPPAITIGLLLVVWEAAVRAGHVSERVLASPTQIIASMVRTWPNLMDAA
AITTYEALTGFAIAIVAGVLIGIGLYLSKTLHRAFYPLLVAAQTIPLITVAPLFMIWFGF
EPLGKIVIVAVFGVFPIAVQTARGLTAVPQFYEDVALTCGATRAWALWHVKLRVAARQIF
GGIRISAAYIFGTAATAEYLGAMNGLGIWLQAAFNSFRTPLIFSATVVVIAETAILLGLI
SLVEWLLLGNGADADISE