Protein Info for BBR_RS13765 in Bifidobacterium breve UCC2003

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 398 to 422 (25 residues), see Phobius details amino acids 443 to 464 (22 residues), see Phobius details amino acids 471 to 493 (23 residues), see Phobius details amino acids 505 to 523 (19 residues), see Phobius details amino acids 567 to 589 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 86% identity to blo:BL0099)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (591 amino acids)

>BBR_RS13765 alpha/beta hydrolase (Bifidobacterium breve UCC2003)
MPQEEQRLTVKAKPWTSLHRLMVSLPIFIMLMGVLVSISNLTTVPWNIEPTGQSMATLTD
DTDVTFANPTGEALPSKGTYQVSERYITLNMTSDGNLTQETGVRGKANKNGVQTIKVLIR
EPQGAAGKRPGVVFMHGAGYGTCDNSFGDVASDMASAGFVTAVLDKPVWNTTDVNRDYMA
SAKAYDQVIAYLRQLENVDNAKVGIYATSESTWISSYLLQDDPDVAFQILLSPMVFSPRQ
SLGFFVTQDFTLAGANDGYQSIVQRVFSADTDLFSLTNFDLDTLKPAAYAVPTFVAYGSK
DVMTAQVDGVRAILHNAHQANNWDVTVRSYPVANHVLRLGDESEAGTPFADAYVNDLIDW
AVGTTAGYTQTSERVAGAGLYQSIGLPGALKARRVGTIYGVIVHVAVVLLLMASTILGLV
ALGRKIALNAQWRRNRREAKRAGMLLPAKPVVLGFAHGFGGSLLTLTLTTLAAMLIFFAG
LGQVIMGVVKLAWGGAPTETPGVMYWSWPVIQVVSVLVVWAWSRVFMRLIEVAWHRGLIQ
LPPRREAVRNIVTGAEPVLASTRLGRVLFWLVAFTMLNVLLFFAFWGLFVY