Protein Info for BBR_RS13755 in Bifidobacterium breve UCC2003

Annotation: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 9 to 379 (371 residues), 365.6 bits, E=1.5e-113
• PF02670: DXP_reductoisom
  • amino acids 9 to 138 (130 residues), 127.1 bits, E=1.1e-40
• PF08436: DXP_redisom_C
  • amino acids 151 to 234 (84 residues), 125.3 bits, E=1.3e-40
• PF13288: DXPR_C
  • amino acids 267 to 386 (120 residues), 107.3 bits, E=8.8e-35

Best Hits

Swiss-Prot: 92% identical to DXR_BIFLS: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 92% identity to bll:BLJ_1372)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Protein Sequence (396 amino acids)

>BBR_RS13755 1-deoxy-D-xylulose-5-phosphate reductoisomerase (Bifidobacterium breve UCC2003)
MSVVSNSTVVILGSTGSIGTQGLDVIARHPERFTVTGLAAGGAHIELLARQAAQFRVPEV
AVFDSTKIPALKEALQQAGARDTRVTGGPDAVIALAGSGANVVLNGITGSIGLEPSIAAL
KANSQLALANKESVVAGGHLLFSAQVRDDQINPVDSEHSAIWQSLRSGTHAEVSKLVVTA
SGGPFRGWKRADMANITPEQALHHPTWNMGPVVTINSSTLMNKGLEVIEASRLFDVPPDR
IDVTVHPQSIVHSMVEFVDGATICQSSPPDMRLPIALGLSAPDRMDNVAAACDWTQAATW
TFEPLDNEAFPAVQLARHCLGASEKHTAVLNAANEQAVHAFLDHRLPYLGIVDTVKAVLD
QMDAELRGNPLFTDVEEMGQIELEARHRADDLINKQ