Protein Info for BBR_RS13750 in Bifidobacterium breve UCC2003

Annotation: DivIVA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 TIGR03543: DivIVA domain repeat protein" amino acids 14 to 205 (192 residues), 239.3 bits, see alignment E=3.2e-75 TIGR03544: DivIVA domain" amino acids 47 to 79 (33 residues), 26.5 bits, see alignment (E = 3.9e-10) amino acids 168 to 199 (32 residues), 23.6 bits, see alignment (E = 3.2e-09)

Best Hits

Predicted SEED Role

"FIG00424036: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>BBR_RS13750 DivIVA domain-containing protein (Bifidobacterium breve UCC2003)
MAQELREGDGKAGIARAGKRKWGYDPAQVDAFLERAHALYDSEGIRLTQRDIQSVSFDLT
KDGYVIAQVDAALNRLERAVVDKQTAWEIAQHGRVTWKAQTENLYQQILEHVEREQGERF
KPGEAKQPSYDKKQVDRLTDQIVDKVAASLGVDGVTEDDVRDLADLNAVSVSNVIFTQRK
GKKGYDERQVDYFLNACVQLLSRIESYARVGGASANEPAAAAAPAPAAAVAAPAEAVSPL
FAANAQRPAADARFAPQAAASDDAFDALHQAEQNLFVARPAAEQADNASAPAAYQPASYA
PASSAAPQPVASDAPSFGAKSAPAAPSTPAVPAVPVAPAAPVTPVAPAVPPTAESDSSLA
ALAHMAQASQDIPAVSVPSFEPKMPSLGTPEELKLNDMPAPVTPAAAPVTAASAAPAAPS
EAPATPEPPHAQTRHQPAPETMPVSFAPANKPVRTTGSVPIPVVDHSDDVPAEPVSTPKP
AAQPSKDAETKRPEQISDMPFPSLFPTSDDFNSSIPDLSFPTLDHDDTKKEQ