Protein Info for BBR_RS13735 in Bifidobacterium breve UCC2003

Annotation: Lon protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 44 to 65 (22 residues), see Phobius details PF05362: Lon_C" amino acids 164 to 278 (115 residues), 49.9 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: K07177, PDZ domain-containing protein (inferred from 84% identity to bll:BLJ_1376)

Predicted SEED Role

"Lon-like protease with PDZ domain" in subsystem Proteasome bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>BBR_RS13735 Lon protease (Bifidobacterium breve UCC2003)
MEAHPEHDDSAASSSNSSKETGQSRFSRAAQRVRRYLAARSPRHFIGAFAVLLGVVILLL
PSPYVIEGPGPTQNVLGSVEDGAVIDVSGKGVSTYQDSGSLLLTTVNASGVPGYTIINAQ
AVWAWANPKMEIMPREATVPVGQTADEYQKTVDKDMAGSQSSASEVGLAYAKAHADELGI
DAASLAHAKVTMHVDSIGGPSAGMMYTLGLIDKLTPESESGGKTIAGTGTIDKKGNVGKI
GGIQLKMLGAKRDGATWFLAPADNCSEVAGHVPDGLRDVKVATLDEAYQALVAIGKGQAD
DLPHCTA