Protein Info for BBR_RS13710 in Bifidobacterium breve UCC2003

Annotation: PHP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02811: PHP
  • amino acids 19 to 82 (64 residues), 35.2 bits, E=7.8e-13

Best Hits

KEGG orthology group: K07053, (no description) (inferred from 86% identity to blf:BLIF_1402)

Predicted SEED Role

"COG0613, Predicted metal-dependent phosphoesterases (PHP family)"

Protein Sequence (297 amino acids)

>BBR_RS13710 PHP domain-containing protein (Bifidobacterium breve UCC2003)
MDSMTGYVMPMEPPTTGWDIHCHTAFSDGTETPAVLAEQSKAVGLKGVSISDHDTTAGWP
QAEAAARKVGLPLLRGTEITATDDGVSVHMLGFQYDPTNQCIVDLFARTRQARLRRTQRM
VELMSKDLPISWESVLAQVKEGGNTTIGRPHIADALVAAGVYQNRSEAFADAVSASSKYY
IPTPSPTAREVVAAVKGADGVILIAHAGDLSRNRRLLSDEQIEALIAEGLDGLEVWHRGN
LPEQRERLLGICARYHLLVTGGSDWHGKGKPNLLGENLTDEATVAEIVRRGALPLYR